PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1194s0071.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 28588.5 Da    PI: 8.552
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1194s0071.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.82.2e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtf+kRrng+lKKA+ELSvLCdaev++i+fs++gklye++s
  Cagra.1194s0071.1.p  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCS 59
                         79***********************************************96 PP

2K-box92.95.6e-3178173499
                K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                           + +++ +++ e++++e+ kLk ++enLqr+qR+llGedL++L+ keL+qLe+qL+ slk++R  K++++l+q+++lq ke+ l e+n+a
  Cagra.1194s0071.1.p  78 IEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLEANRA 167
                          56667788999******************************************************************************* PP

                K-box  94 Lrkkle 99 
                          L+ kle
  Cagra.1194s0071.1.p 168 LSVKLE 173
                          *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.319161IPR002100Transcription factor, MADS-box
SMARTSM004324.2E-41160IPR002100Transcription factor, MADS-box
CDDcd002654.59E-45277No hitNo description
SuperFamilySSF554551.11E-33280IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-32323IPR002100Transcription factor, MADS-box
PfamPF003199.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-323859IPR002100Transcription factor, MADS-box
PfamPF014867.1E-2585172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.3888178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0048481Biological Processplant ovule development
GO:0071486Biological Processcellular response to high light intensity
GO:0071492Biological Processcellular response to UV-A
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVSLIVFSN RGKLYEFCST  60
SNMLKTLERY QKCSYGSIEV NNKPAKELEN SYREYLKLKG RYENLQRQQR NLLGEDLGPL  120
NSKELEQLER QLDGSLKQVR CIKTQYMLDQ LSDLQGKEHI LLEANRALSV KLEDMIGVRH  180
HHIGGAWEAG DQQNVVYGHH QAHSQGLYQS LECDPTLQIG YGHPVCSEQM AVATQGHNQP  240
GNGYIPGWML *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A1e-33751741103Developmental protein SEPALLATA 3
4ox0_B1e-33751741103Developmental protein SEPALLATA 3
4ox0_C1e-33751741103Developmental protein SEPALLATA 3
4ox0_D1e-33751741103Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4159180.0DQ415918.1 Boechera stricta SEP2 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298399.10.0hypothetical protein CARUB_v10014470mg
SwissprotP293841e-178SEP2_ARATH; Developmental protein SEPALLATA 2
TrEMBLR0G6P70.0R0G6P7_9BRAS; Uncharacterized protein
STRINGscaffold_300166.11e-177(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32892765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.11e-179MIKC_MADS family protein